PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10017157m
Common NameEUTSA_v10017047mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 247aa    MW: 28162.7 Da    PI: 9.3968
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10017157mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.65e-312473150
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva++ifs++g+lyey+
  Thhalv10017157m 24 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALVIFSTRGRLYEYA 73
                     79***********************************************8 PP

2K-box111.87.1e-37951887100
            K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                       s++ea+++++qqe++kL+++i+ +q+ +Rh+lGe+L+sL+lkeL++Le++Lek+++++RskK+e+l+++ie++qk+e elq++n++Lr+k+ e
  Thhalv10017157m  95 PSVTEANTQYYQQESSKLRRQIRDIQNLNRHILGESLGSLNLKELKNLESRLEKGISRVRSKKHEMLVAEIEYMQKREIELQNDNMYLRSKITE 188
                      45899**************************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.1E-401675IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.3891676IPR002100Transcription factor, MADS-box
CDDcd002652.64E-431790No hitNo description
SuperFamilySSF554551.96E-321789IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-321838IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001872IPR002100Transcription factor, MADS-box
PfamPF003193.3E-262572IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-323853IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-325374IPR002100Transcription factor, MADS-box
PfamPF014861.7E-25100186IPR002487Transcription factor, K-box
PROSITE profilePS5129714.905102192IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MEGGASNEVA ESSKKIGRGK IEIKRIENTT NRQVTFCKRR NGLLKKAYEL SVLCDAEVAL  60
VIFSTRGRLY EYANNSVRGT IERYKKACSD AVNPPSVTEA NTQYYQQESS KLRRQIRDIQ  120
NLNRHILGES LGSLNLKELK NLESRLEKGI SRVRSKKHEM LVAEIEYMQK REIELQNDNM  180
YLRSKITERV GLQQQESSVI HQGTVYESGV SSSHQSDQYN RSYIPVNLLE PNQNPSDQDQ  240
PPLQLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-201684169Myocyte-specific enhancer factor 2B
1tqe_Q3e-201684169Myocyte-specific enhancer factor 2B
1tqe_R3e-201684169Myocyte-specific enhancer factor 2B
1tqe_S3e-201684169Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9730920.0JQ973092.1 Arabidopsis thaliana Shatterproof (SHP2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411552.10.0hypothetical protein EUTSA_v10017047mg
SwissprotP293851e-175AGL5_ARATH; Agamous-like MADS-box protein AGL5
TrEMBLV4LR270.0V4LR27_EUTSA; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_40020191e-172(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42830.11e-151MIKC_MADS family protein